Lineage for d1xrsa_ (1xrs A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089476Superfamily c.1.19: Cobalamin (vitamin B12)-dependent enzymes [51703] (4 families) (S)
  5. 2089547Family c.1.19.4: D-lysine 5,6-aminomutase alpha subunit, KamD [117392] (1 protein)
    most similar to the glutamate mutase subunit; contains second cofactor, PLP
    automatically mapped to Pfam PF09043
  6. 2089548Protein D-lysine 5,6-aminomutase alpha subunit, KamD [117393] (1 species)
  7. 2089549Species Clostridium sticklandii [TaxId:1511] [117394] (1 PDB entry)
    Uniprot Q9ZFE6
  8. 2089550Domain d1xrsa_: 1xrs A: [115883]
    Other proteins in same PDB: d1xrsb1, d1xrsb2
    complexed with 5ad, b12, plp

Details for d1xrsa_

PDB Entry: 1xrs (more details), 2.8 Å

PDB Description: crystal structure of lysine 5,6-aminomutase in complex with plp, cobalamin, and 5'-deoxyadenosine
PDB Compounds: (A:) D-lysine 5,6-aminomutase alpha subunit

SCOPe Domain Sequences for d1xrsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xrsa_ c.1.19.4 (A:) D-lysine 5,6-aminomutase alpha subunit, KamD {Clostridium sticklandii [TaxId: 1511]}
mesklnldfnlvekarakakaiaidtqefiekhttvtveravcrllgidgvdtdevplpn
ivvdhikennglnlgaamyianavlntgktpqeiaqaisageldltklpmkdlfevktka
lsmaketvekiknnrsiresrfeeygdksgpllyvivatgniyeditqavaaakqgadvi
avirttgqslldyvpygattegfggtyatqenfrlmrealdkvgaevgkyirlcnycsgl
cmpeiaamgaierldvmlndalygilfrdinmqrtmidqnfsriingfagviintgedny
lttadafeeahtvlasqfineqfallaglpeeqmglghafemdpelkngflyelsqaqma
reifpkaplkympptkfmtgnifkghiqdalfnmvtimtnqrihllgmltealhtpfmsd
ralsienaqyifnnmesiseeiqfkedgliqkragfvlekanelleeieqlglfdtlekg
ifggvkrpkdggkglngvvskdenyynpfvelmlnk

SCOPe Domain Coordinates for d1xrsa_:

Click to download the PDB-style file with coordinates for d1xrsa_.
(The format of our PDB-style files is described here.)

Timeline for d1xrsa_: