SCOPe 2.08: Domain d1xrkb_: 1xrk B:

Lineage for d1xrkb_ (1xrk B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins)
   duplication: consists of two clear structural repeats each having this fold
   subunit fold and dimeric assembly are similar to those of glyoxalase

6. Protein Bleomycin resistance protein, BRP [54599] (3 species)
   Active as dimer

7. Species Streptoalloteichus hindustanus [TaxId:2017] [54601] (2 PDB entries)
   Uniprot P17493

8. Domain d1xrkb_: 1xrk B: [115882]
   complexed with blm, so4; mutant

Details for d1xrkb_

PDB Entry: 1xrk, 1.5 Å

PDB Description: crystal structure of a mutant bleomycin binding protein from streptoalloteichus hindustanus displaying increased thermostability

PDB Compounds: (B:) bleomycin resistance protein

SCOPe Domain Sequences for d1xrkb_:

Sequence; same for both SEQRES and ATOM records:

>d1xrkb_ d.32.1.2 (B:) Bleomycin resistance protein, BRP {Streptoalloteichus hindustanus [TaxId: 2017]}
akltsavpvltardvaeavefwtdrlgfsrvfveddfagvvrddvtlfisavqdqvvpdn
tqawvwvrgldelyaewsevvstnfrdasgpamteiveqpwgrefalrdpagncvhfvae
e

Timeline for d1xrkb_:

• d1xrkb_ first appeared in SCOP 1.71
  
• d1xrkb_ appears in SCOPe 2.07