![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
![]() | Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) ![]() |
![]() | Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins) duplication: consists of two clear structural repeats each having this fold subunit fold and dimeric assembly are similar to those of glyoxalase |
![]() | Protein Bleomycin resistance protein, BRP [54599] (3 species) Active as dimer |
![]() | Species Streptoalloteichus hindustanus [TaxId:2017] [54601] (2 PDB entries) Uniprot P17493 |
![]() | Domain d1xrka_: 1xrk A: [115881] complexed with blm, so4; mutant |
PDB Entry: 1xrk (more details), 1.5 Å
SCOPe Domain Sequences for d1xrka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xrka_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptoalloteichus hindustanus [TaxId: 2017]} akltsavpvltardvaeavefwtdrlgfsrvfveddfagvvrddvtlfisavqdqvvpdn tqawvwvrgldelyaewsevvstnfrdasgpamteiveqpwgrefalrdpagncvhfvae
Timeline for d1xrka_: