Lineage for d1xrhg1 (1xrh G:4-342)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2169228Fold c.122: L-sulfolactate dehydrogenase-like [89732] (1 superfamily)
    core: 3 layers, a/b/a; mixed sheet of 7 strands, order 1237456; strands 1, 6 and 7 are antiparallel to the rest
  4. 2169229Superfamily c.122.1: L-sulfolactate dehydrogenase-like [89733] (2 families) (S)
    topological similarity to the domain 2 of TM1585
    automatically mapped to Pfam PF02615
  5. 2169230Family c.122.1.1: L-sulfolactate dehydrogenase-like [89734] (4 proteins)
    Pfam PF02615; type II malate/L-lactate dehydrogenase;
  6. 2169253Protein Ureidoglycolate dehydrogenase AllD [117675] (1 species)
  7. 2169254Species Escherichia coli [TaxId:562] [117676] (1 PDB entry)
    Uniprot P77555
  8. 2169261Domain d1xrhg1: 1xrh G:4-342 [115877]
    Other proteins in same PDB: d1xrha2, d1xrhb2, d1xrhc2, d1xrhd2, d1xrhe2, d1xrhf2, d1xrhg2, d1xrhh2

Details for d1xrhg1

PDB Entry: 1xrh (more details), 2.25 Å

PDB Description: crystal structure of ureidoglycolate dehydrogenase from escherichia coli
PDB Compounds: (G:) Ureidoglycolate Dehydrogenase

SCOPe Domain Sequences for d1xrhg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xrhg1 c.122.1.1 (G:4-342) Ureidoglycolate dehydrogenase AllD {Escherichia coli [TaxId: 562]}
kisretlhqlienklcqaglkrehaatvaevlvyadargihshgavrveyyaeriskggt
nrepefrleetgpcsailhadnaagqvaakmgmehaiktaqqngvavvgisrmghsgais
yfvqqaaragfigismcqsdpmvvpfggaeiyygtnplafaapgegdeiltfdmattvqa
wgkvldarsrnmsipdtwavdkngvpttdpfavhallpaagpkgyglmmmidvlsgvllg
lpfgrqvssmyddlhagrnlgqlhivinpnffssselfrqhlsqtmrelnaitpapgfnq
vyypgqdqdikqrkaavegieivddiyqylisdalynts

SCOPe Domain Coordinates for d1xrhg1:

Click to download the PDB-style file with coordinates for d1xrhg1.
(The format of our PDB-style files is described here.)

Timeline for d1xrhg1: