Lineage for d1xrhc_ (1xrh C:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 595241Fold c.122: L-sulfolactate dehydrogenase-like [89732] (1 superfamily)
    core: 3 layers, a/b/a; mixed sheet of 7 strands, order 1237456; strands 1, 6 and 7 are antiparallel to the rest
  4. 595242Superfamily c.122.1: L-sulfolactate dehydrogenase-like [89733] (1 family) (S)
    topological similarity to the domain 2 of TM1585
  5. 595243Family c.122.1.1: L-sulfolactate dehydrogenase-like [89734] (3 proteins)
    Pfam 02615; type II malate/L-lactate dehydrogenase;
  6. 595266Protein Ureidoglycolate dehydrogenase AllD [117675] (1 species)
  7. 595267Species Escherichia coli [TaxId:562] [117676] (1 PDB entry)
  8. 595270Domain d1xrhc_: 1xrh C: [115873]

Details for d1xrhc_

PDB Entry: 1xrh (more details), 2.25 Å

PDB Description: crystal structure of ureidoglycolate dehydrogenase from escherichia coli

SCOP Domain Sequences for d1xrhc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xrhc_ c.122.1.1 (C:) Ureidoglycolate dehydrogenase AllD {Escherichia coli}
ssskisretlhqlienklcqaglkrehaatvaevlvyadargihshgavrveyyaerisk
ggtnrepefrleetgpcsailhadnaagqvaakmgmehaiktaqqngvavvgisrmghsg
aisyfvqqaaragfigismcqsdpmvvpfggaeiyygtnplafaapgegdeiltfdmatt
vqawgkvldarsrnmsipdtwavdkngvpttdpfavhallpaagpkgyglmmmidvlsgv
llglpfgrqvssmyddlhagrnlgqlhivinpnffssselfrqhlsqtmrelnaitpapg
fnqvyypgqdqdikqrkaavegieivddiyqylisdalyntsye

SCOP Domain Coordinates for d1xrhc_:

Click to download the PDB-style file with coordinates for d1xrhc_.
(The format of our PDB-style files is described here.)

Timeline for d1xrhc_: