Lineage for d1xrgc1 (1xrg C:1-126)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2525085Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2525086Superfamily d.79.1: YjgF-like [55298] (3 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2525087Family d.79.1.1: YjgF/L-PSP [55299] (12 proteins)
    some members possess an endoribonuclease activity inhibiting mRNA translation
  6. 2525152Protein Purine regulatory protein YabJ [55302] (2 species)
  7. 2525157Species Clostridium thermocellum [TaxId:1515] [118024] (1 PDB entry)
    Uniprot Q4CI45
  8. 2525160Domain d1xrgc1: 1xrg C:1-126 [115870]
    Other proteins in same PDB: d1xrgb2, d1xrgc2
    Structural genomics target
    complexed with unx

Details for d1xrgc1

PDB Entry: 1xrg (more details), 2.2 Å

PDB Description: conserved hypothetical protein from clostridium thermocellum cth-2968
PDB Compounds: (C:) Putative translation initiation inhibitor, yjgF family

SCOPe Domain Sequences for d1xrgc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xrgc1 d.79.1.1 (C:1-126) Purine regulatory protein YabJ {Clostridium thermocellum [TaxId: 1515]}
myievvktnkapeaigpysqaivtgsfvytsgqipinpqtgevvdggieeqakqvlenlk
nvleaagsslnkvvkttvfikdmdsfakvnevyakyfsepyparscvevsklpkgvliei
eavaik

SCOPe Domain Coordinates for d1xrgc1:

Click to download the PDB-style file with coordinates for d1xrgc1.
(The format of our PDB-style files is described here.)

Timeline for d1xrgc1: