SCOPe 2.08: Domain d1xrgb1: 1xrg B:1-126

Lineage for d1xrgb1 (1xrg B:1-126)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.1: YjgF-like [55298] (4 families)
   forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.1.1: YjgF/L-PSP [55299] (12 proteins)
   some members possess an endoribonuclease activity inhibiting mRNA translation

6. Protein Purine regulatory protein YabJ [55302] (2 species)

7. Species Clostridium thermocellum [TaxId:1515] [118024] (1 PDB entry)
   Uniprot Q4CI45

8. Domain d1xrgb1: 1xrg B:1-126 [115869]
   Other proteins in same PDB: d1xrgb2, d1xrgc2
   Structural genomics target
   complexed with unx

Details for d1xrgb1

PDB Entry: 1xrg, 2.2 Å

PDB Description: conserved hypothetical protein from clostridium thermocellum cth-2968

PDB Compounds: (B:) Putative translation initiation inhibitor, yjgF family

SCOPe Domain Sequences for d1xrgb1:

Sequence; same for both SEQRES and ATOM records:

>d1xrgb1 d.79.1.1 (B:1-126) Purine regulatory protein YabJ {Clostridium thermocellum [TaxId: 1515]}
myievvktnkapeaigpysqaivtgsfvytsgqipinpqtgevvdggieeqakqvlenlk
nvleaagsslnkvvkttvfikdmdsfakvnevyakyfsepyparscvevsklpkgvliei
eavaik

Timeline for d1xrgb1:

• d1xrgb1 first appeared in SCOP 1.71, called d1xrgb_
  
• d1xrgb1 appears in SCOPe 2.07