![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.1: YjgF-like [55298] (4 families) ![]() forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
![]() | Family d.79.1.1: YjgF/L-PSP [55299] (12 proteins) some members possess an endoribonuclease activity inhibiting mRNA translation |
![]() | Protein Purine regulatory protein YabJ [55302] (2 species) |
![]() | Species Clostridium thermocellum [TaxId:1515] [118024] (1 PDB entry) Uniprot Q4CI45 |
![]() | Domain d1xrgb1: 1xrg B:1-126 [115869] Other proteins in same PDB: d1xrgb2, d1xrgc2 Structural genomics target complexed with unx |
PDB Entry: 1xrg (more details), 2.2 Å
SCOPe Domain Sequences for d1xrgb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xrgb1 d.79.1.1 (B:1-126) Purine regulatory protein YabJ {Clostridium thermocellum [TaxId: 1515]} myievvktnkapeaigpysqaivtgsfvytsgqipinpqtgevvdggieeqakqvlenlk nvleaagsslnkvvkttvfikdmdsfakvnevyakyfsepyparscvevsklpkgvliei eavaik
Timeline for d1xrgb1: