Lineage for d1xr6a_ (1xr6 A:)

  1. Root: SCOP 1.73
  2. 742018Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)
  3. 743030Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 743031Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 743413Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (2 proteins)
  6. 743421Protein Viral RNA polymerase [56695] (9 species)
  7. 743477Species Human rhinovirus 1B, HRV-1B [TaxId:12129] [111299] (1 PDB entry)
  8. 743478Domain d1xr6a_: 1xr6 A: [115865]
    complexed with k

Details for d1xr6a_

PDB Entry: 1xr6 (more details), 2.5 Å

PDB Description: Crystal Structure of RNA-dependent RNA Polymerase 3D from human rhinovirus serotype 1B
PDB Compounds: (A:) Genome polyprotein

SCOP Domain Sequences for d1xr6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xr6a_ e.8.1.4 (A:) Viral RNA polymerase {Human rhinovirus 1B, HRV-1B [TaxId: 12129]}
gqikiskhanecglptihtpsktklqpsvfydvfpgskepavltdndprlkvnfkealfs
kykgntecslnqhmeiaiahysaqlitldidskpialedsvfgieglealdlntsagfpy
vtmgikkrdlinnktkdisrlkealdkygvdlpmitflkdelrkkekisagktrvieass
indtilfrttfgnlfskfhlnpgvvtgsavgcdpetfwskipvmldgdcimafdytnydg
sihpvwfqalkkvlenlsfqsnlidrlcyskhlfkstyyevaggvpsgcsgtsifntmin
niiirtlvldayknidldklkiiaygddvifsykytldmeaianegkkygltitpadkst
efkkldynnvtflkrgfkqdekhtflihptfpveeiyesirwtkkpsqmqehvlslchlm
whngrkvyedfsskirsvsagralyippydllkhewyekf

SCOP Domain Coordinates for d1xr6a_:

Click to download the PDB-style file with coordinates for d1xr6a_.
(The format of our PDB-style files is described here.)

Timeline for d1xr6a_: