SCOPe 2.08: Domain d1xr6a_: 1xr6 A:

Lineage for d1xr6a_ (1xr6 A:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)

6. Protein Viral RNA polymerase [56695] (17 species)

7. Species Human rhinovirus 1B, HRV-1B [TaxId:12129] [111299] (2 PDB entries)
   Uniprot P12916 1698-2157

8. Domain d1xr6a_: 1xr6 A: [115865]
   complexed with k
   missing some secondary structures that made up less than one-third of the common domain

Details for d1xr6a_

PDB Entry: 1xr6, 2.5 Å

PDB Description: Crystal Structure of RNA-dependent RNA Polymerase 3D from human rhinovirus serotype 1B

PDB Compounds: (A:) Genome polyprotein

SCOPe Domain Sequences for d1xr6a_:

Sequence; same for both SEQRES and ATOM records:

>d1xr6a_ e.8.1.4 (A:) Viral RNA polymerase {Human rhinovirus 1B, HRV-1B [TaxId: 12129]}
gqikiskhanecglptihtpsktklqpsvfydvfpgskepavltdndprlkvnfkealfs
kykgntecslnqhmeiaiahysaqlitldidskpialedsvfgieglealdlntsagfpy
vtmgikkrdlinnktkdisrlkealdkygvdlpmitflkdelrkkekisagktrvieass
indtilfrttfgnlfskfhlnpgvvtgsavgcdpetfwskipvmldgdcimafdytnydg
sihpvwfqalkkvlenlsfqsnlidrlcyskhlfkstyyevaggvpsgcsgtsifntmin
niiirtlvldayknidldklkiiaygddvifsykytldmeaianegkkygltitpadkst
efkkldynnvtflkrgfkqdekhtflihptfpveeiyesirwtkkpsqmqehvlslchlm
whngrkvyedfsskirsvsagralyippydllkhewyekf

Timeline for d1xr6a_:

• d1xr6a_ first appeared in SCOP 1.71
  
• d1xr6a_ appears in SCOPe 2.07