Lineage for d1xr4b1 (1xr4 B:1-236)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 595310Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 595311Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (6 families) (S)
  5. 595342Family c.124.1.2: CoA transferase alpha subunit-like [74656] (4 proteins)
    parallel beta-sheet of 7 strands, order 4321567
  6. 595351Protein Putative citrate lyase alpha chain, citF2 [117515] (1 species)
    duplication: consists of two topologically similar domains
  7. 595352Species Salmonella typhimurium [TaxId:90371] [117516] (1 PDB entry)
  8. 595355Domain d1xr4b1: 1xr4 B:1-236 [115862]

Details for d1xr4b1

PDB Entry: 1xr4 (more details), 2.37 Å

PDB Description: X-ray crystal structure of putative citrate lyase alpha chain/citrate-ACP transferase [Salmonella typhimurium]

SCOP Domain Sequences for d1xr4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xr4b1 c.124.1.2 (B:1-236) Putative citrate lyase alpha chain, citF2 {Salmonella typhimurium}
mketvtmlnqqyvvpeglqpyqgvtanspwlasetekrrrkicdsleeairrsglkngmt
isfhhafrggdkvvnmvmaklaemgfrdltlassslidahwpliehikngvvrqiytsgl
rgklgeeisaglmenpvqihshggrvkliqsgelnidvaflgvpccdefgnangfsgksr
cgslgyaqvdaqyakcvvllteewvefpnypasiaqdqvdlivqvdevgdpekita

SCOP Domain Coordinates for d1xr4b1:

Click to download the PDB-style file with coordinates for d1xr4b1.
(The format of our PDB-style files is described here.)

Timeline for d1xr4b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xr4b2