![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily) core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) ![]() |
![]() | Family c.124.1.2: CoA transferase alpha subunit-like [74656] (7 proteins) parallel beta-sheet of 7 strands, order 4321567 |
![]() | Protein Putative citrate lyase alpha chain, citF2 [117515] (1 species) duplication: consists of two topologically similar domains |
![]() | Species Salmonella typhimurium [TaxId:90371] [117516] (1 PDB entry) Uniprot Q8ZRY1 |
![]() | Domain d1xr4b1: 1xr4 B:1-236 [115862] Other proteins in same PDB: d1xr4a3, d1xr4b3 Structural genomics target |
PDB Entry: 1xr4 (more details), 2.37 Å
SCOPe Domain Sequences for d1xr4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xr4b1 c.124.1.2 (B:1-236) Putative citrate lyase alpha chain, citF2 {Salmonella typhimurium [TaxId: 90371]} mketvtmlnqqyvvpeglqpyqgvtanspwlasetekrrrkicdsleeairrsglkngmt isfhhafrggdkvvnmvmaklaemgfrdltlassslidahwpliehikngvvrqiytsgl rgklgeeisaglmenpvqihshggrvkliqsgelnidvaflgvpccdefgnangfsgksr cgslgyaqvdaqyakcvvllteewvefpnypasiaqdqvdlivqvdevgdpekita
Timeline for d1xr4b1: