Lineage for d1xr4a2 (1xr4 A:237-505)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2922305Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2922306Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2922354Family c.124.1.2: CoA transferase alpha subunit-like [74656] (7 proteins)
    parallel beta-sheet of 7 strands, order 4321567
  6. 2922369Protein Putative citrate lyase alpha chain, citF2 [117515] (1 species)
    duplication: consists of two topologically similar domains
  7. 2922370Species Salmonella typhimurium [TaxId:90371] [117516] (1 PDB entry)
    Uniprot Q8ZRY1
  8. 2922372Domain d1xr4a2: 1xr4 A:237-505 [115861]
    Other proteins in same PDB: d1xr4a3, d1xr4b3
    Structural genomics target

Details for d1xr4a2

PDB Entry: 1xr4 (more details), 2.37 Å

PDB Description: X-ray crystal structure of putative citrate lyase alpha chain/citrate-ACP transferase [Salmonella typhimurium]
PDB Compounds: (A:) putative citrate lyase alpha chain/citrate-ACP transferase

SCOPe Domain Sequences for d1xr4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xr4a2 c.124.1.2 (A:237-505) Putative citrate lyase alpha chain, citF2 {Salmonella typhimurium [TaxId: 90371]}
gairlssnprelliarqaanviehsgyfcdgfslqtgtggaslavtrfledkmrrhnita
sfglggitgtmvdlhekglikalldtqsfdgdaarslaqnphhieistnqyanpaskgaa
cerlnvvmlsaleidvnfnvnvmtgsngvlrgasgghsdtaagadltiitaplvrgripc
vvekvlttvtpgasvdvlvtdhgiavnparqdlldnlraagvalmtieqlqqraeqltgk
pqpieftdrvvavvryrdgsvidvirqvk

SCOPe Domain Coordinates for d1xr4a2:

Click to download the PDB-style file with coordinates for d1xr4a2.
(The format of our PDB-style files is described here.)

Timeline for d1xr4a2: