Lineage for d1xr1a_ (1xr1 A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. Protein Proto-oncogene serine/threonine-protein kinase Pim-1 [118133] (1 species)
    OPK group(?); PIM subfamily; serine/threonine kinase
  7. Species Human (Homo sapiens) [TaxId:9606] [118134] (118 PDB entries)
    Uniprot P11309 33-305 ! Uniprot P11309 32-308
  8. Domain d1xr1a_: 1xr1 A: [115859]
    complexed with anp, mg

Details for d1xr1a_

PDB Entry: 1xr1 (more details), 2.1 Å

PDB Description: crystal structure of hpim-1 kinase in complex with amp-pnp at 2.1 a resolution
PDB Compounds: (A:) Proto-oncogene serine/threonine-protein kinase Pim-1

SCOPe Domain Sequences for d1xr1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xr1a_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]}
eplesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevv
llkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqv
leavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppe
wiryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwcl
alrpsdrptfeeiqnhpwmqdvllpqetaeihlhsls

SCOPe Domain Coordinates for d1xr1a_ are not available.

Timeline for d1xr1a_: