Lineage for d1xqpa_ (1xqp A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1742126Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 1742127Superfamily a.96.1: DNA-glycosylase [48150] (7 families) (S)
  5. 1742256Family a.96.1.6: AgoG-like [116976] (2 proteins)
    automatically mapped to Pfam PF09171
  6. 1742257Protein 8-oxoguanine DNA glycosylase, AgoG [116977] (1 species)
  7. 1742258Species Pyrobaculum aerophilum [TaxId:13773] [116978] (2 PDB entries)
    Uniprot Q8ZVK6 # PAE2237
  8. 1742260Domain d1xqpa_: 1xqp A: [115854]
    protein/DNA complex; complexed with 8hg

Details for d1xqpa_

PDB Entry: 1xqp (more details), 1.69 Å

PDB Description: crystal structure of 8-oxoguanosine complexed pa-agog, 8-oxoguanine dna glycosylase from pyrobaculum aerophilum
PDB Compounds: (A:) 8-oxoguanine DNA glycosylase

SCOPe Domain Sequences for d1xqpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xqpa_ a.96.1.6 (A:) 8-oxoguanine DNA glycosylase, AgoG {Pyrobaculum aerophilum [TaxId: 13773]}
aesqlkrvietlrrlgieevlklerrdpqyravcnvvkrhgetvgsrlamlnalisyrlt
gkgeehweyfgkyfsqlevidlcrdflkyietspflkigvearkkralkacdyvpnledl
gltlrqlshivgarreqktlvftikilnyaymcsrgvnrvlpfdipipvdyrvarltwca
glidfppeealrryeavqkiwdavaretgipplhldtllwlagravlygenlhgvpkevi
alfqwrggcrpp

SCOPe Domain Coordinates for d1xqpa_:

Click to download the PDB-style file with coordinates for d1xqpa_.
(The format of our PDB-style files is described here.)

Timeline for d1xqpa_: