SCOP 1.71: Domain d1xqpa_: 1xqp A:

Lineage for d1xqpa_ (1xqp A:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.96.1: DNA-glycosylase [48150] (6 families)

5. Family a.96.1.6: AgoG-like [116976] (2 proteins)

6. Protein 8-oxoguanine DNA glycosylase, AgoG [116977] (1 species)

7. Species Pyrobaculum aerophilum [TaxId:13773] [116978] (2 PDB entries)

8. Domain d1xqpa_: 1xqp A: [115854]
   complexed with 8hg

Details for d1xqpa_

PDB Entry: 1xqp, 1.69 Å

PDB Description: crystal structure of 8-oxoguanosine complexed pa-agog, 8-oxoguanine dna glycosylase from pyrobaculum aerophilum

SCOP Domain Sequences for d1xqpa_:

Sequence; same for both SEQRES and ATOM records:

>d1xqpa_ a.96.1.6 (A:) 8-oxoguanine DNA glycosylase, AgoG {Pyrobaculum aerophilum}
aesqlkrvietlrrlgieevlklerrdpqyravcnvvkrhgetvgsrlamlnalisyrlt
gkgeehweyfgkyfsqlevidlcrdflkyietspflkigvearkkralkacdyvpnledl
gltlrqlshivgarreqktlvftikilnyaymcsrgvnrvlpfdipipvdyrvarltwca
glidfppeealrryeavqkiwdavaretgipplhldtllwlagravlygenlhgvpkevi
alfqwrggcrpp

Timeline for d1xqpa_:

• d1xqpa_ is new in SCOP 1.71
  
• d1xqpa_ appears in SCOP 1.73
  
• d1xqpa_ appears in the current release, SCOPe 2.08