Lineage for d1xqna_ (1xqn A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 555832Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 555833Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) (S)
  5. 555834Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 555838Protein Concanavalin A [49901] (2 species)
    natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop
  7. 555844Species Jack bean (Canavalia ensiformis) [TaxId:3823] [49902] (48 PDB entries)
  8. 555957Domain d1xqna_: 1xqn A: [115852]
    complexed with ca, mn

Details for d1xqna_

PDB Entry: 1xqn (more details), 2.5 Å

PDB Description: the 15k neutron structure of saccharide-free concanavalin a

SCOP Domain Sequences for d1xqna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xqna_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis)}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

SCOP Domain Coordinates for d1xqna_:

Click to download the PDB-style file with coordinates for d1xqna_.
(The format of our PDB-style files is described here.)

Timeline for d1xqna_: