Lineage for d1xqma_ (1xqm A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546826Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2546827Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2546828Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2546829Protein GFP-like non-fluorescent chromoprotein FP595 [117863] (1 species)
  7. 2546830Species Sea anemone (Anemonia sulcata) [TaxId:6108] [117864] (1 PDB entry)
    Uniprot Q9GZ28 # 95% sequence identity
  8. 2546831Domain d1xqma_: 1xqm A: [115851]
    complexed with acy

Details for d1xqma_

PDB Entry: 1xqm (more details), 2.1 Å

PDB Description: Variations on the GFP chromophore scaffold: A fragmented 5-membered heterocycle revealed in the 2.1A crystal structure of a non-fluorescent chromoprotein
PDB Compounds: (A:) kindling fluorescent protein

SCOPe Domain Sequences for d1xqma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xqma_ d.22.1.1 (A:) GFP-like non-fluorescent chromoprotein FP595 {Sea anemone (Anemonia sulcata) [TaxId: 6108]}
slltetmpfkttiegtvnghcfkcigkgegnpfegtqemkievieggplpfafhilstsc
mygsktfikyvsgipdyfkqsfpegftwertttyedggfltahqdtsldgdclvykvkil
gnnfpadgpvmqnkvgrwepgteivyevdgvlrgqslmalkcpggrhltchlhttyrskk
pasalkmpgfhfedhrieimeevekgkcykqyeaavgrycdaapsklghn

SCOPe Domain Coordinates for d1xqma_:

Click to download the PDB-style file with coordinates for d1xqma_.
(The format of our PDB-style files is described here.)

Timeline for d1xqma_: