Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
Protein GFP-like non-fluorescent chromoprotein FP595 [117863] (1 species) |
Species Sea anemone (Anemonia sulcata) [TaxId:6108] [117864] (1 PDB entry) Uniprot Q9GZ28 # 95% sequence identity |
Domain d1xqma_: 1xqm A: [115851] complexed with acy |
PDB Entry: 1xqm (more details), 2.1 Å
SCOPe Domain Sequences for d1xqma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xqma_ d.22.1.1 (A:) GFP-like non-fluorescent chromoprotein FP595 {Sea anemone (Anemonia sulcata) [TaxId: 6108]} slltetmpfkttiegtvnghcfkcigkgegnpfegtqemkievieggplpfafhilstsc mygsktfikyvsgipdyfkqsfpegftwertttyedggfltahqdtsldgdclvykvkil gnnfpadgpvmqnkvgrwepgteivyevdgvlrgqslmalkcpggrhltchlhttyrskk pasalkmpgfhfedhrieimeevekgkcykqyeaavgrycdaapsklghn
Timeline for d1xqma_: