| Class b: All beta proteins [48724] (165 folds) |
| Fold b.76: open-sided beta-meander [51086] (2 superfamilies) single sheet formed by beta-hairpin repeats; exposed on both sides in the middle |
Superfamily b.76.2: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82185] (1 family) ![]() 11+ stranded sheet partly folded upon itself at the C-end |
| Family b.76.2.1: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82186] (1 protein) |
| Protein Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82187] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [82188] (8 PDB entries) |
| Domain d1xqhe1: 1xqh E:117-193 [115848] Other proteins in same PDB: d1xqha2, d1xqhe2 N-terminally truncated complexed with mlz, sah |
PDB Entry: 1xqh (more details), 1.75 Å
SCOP Domain Sequences for d1xqhe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xqhe1 b.76.2.1 (E:117-193) Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
gvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklatlmste
egrphfelmpgnsvyhf
Timeline for d1xqhe1: