SCOP 1.71: Domain d1xqhe1: 1xqh E:117-193

Lineage for d1xqhe1 (1xqh E:117-193)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.76: open-sided beta-meander [51086] (2 superfamilies)
   single sheet formed by beta-hairpin repeats; exposed on both sides in the middle

4. Superfamily b.76.2: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82185] (1 family)
   11+ stranded sheet partly folded upon itself at the C-end

5. Family b.76.2.1: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82186] (1 protein)

6. Protein Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82187] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82188] (7 PDB entries)

8. Domain d1xqhe1: 1xqh E:117-193 [115848]
   Other proteins in same PDB: d1xqha2, d1xqhe2
   N-terminally truncated
   complexed with mlz, sah

Details for d1xqhe1

PDB Entry: 1xqh, 1.75 Å

PDB Description: Crystal structure of a ternary complex of the methyltransferase SET9 (also known as SET7/9) with a P53 peptide and SAH

SCOP Domain Sequences for d1xqhe1:

Sequence; same for both SEQRES and ATOM records:

>d1xqhe1 b.76.2.1 (E:117-193) Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain {Human (Homo sapiens)}
gvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklatlmste
egrphfelmpgnsvyhf

Timeline for d1xqhe1:

• d1xqhe1 is new in SCOP 1.71
  
• d1xqhe1 appears in SCOP 1.73
  
• d1xqhe1 appears in the current release, SCOPe 2.08