Lineage for d1xqhe1 (1xqh E:117-193)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2068816Fold b.76: open-sided beta-meander [51086] (2 superfamilies)
    single sheet formed by beta-hairpin repeats; exposed on both sides in the middle
  4. 2068846Superfamily b.76.2: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82185] (1 family) (S)
    11+ stranded sheet partly folded upon itself at the C-end
  5. 2068847Family b.76.2.1: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82186] (1 protein)
  6. 2068848Protein Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82187] (1 species)
  7. 2068849Species Human (Homo sapiens) [TaxId:9606] [82188] (18 PDB entries)
    Uniprot Q8WTS6 52-366
  8. 2068872Domain d1xqhe1: 1xqh E:117-193 [115848]
    Other proteins in same PDB: d1xqha2, d1xqhe2
    N-terminally truncated
    complexed with sah

Details for d1xqhe1

PDB Entry: 1xqh (more details), 1.75 Å

PDB Description: Crystal structure of a ternary complex of the methyltransferase SET9 (also known as SET7/9) with a P53 peptide and SAH
PDB Compounds: (E:) histone-lysine n-methyltransferase, h3 lysine-4 specific

SCOPe Domain Sequences for d1xqhe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xqhe1 b.76.2.1 (E:117-193) Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
gvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklatlmste
egrphfelmpgnsvyhf

SCOPe Domain Coordinates for d1xqhe1:

Click to download the PDB-style file with coordinates for d1xqhe1.
(The format of our PDB-style files is described here.)

Timeline for d1xqhe1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xqhe2