| Class b: All beta proteins [48724] (149 folds) |
| Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.7: SET domain [82199] (3 families) ![]() duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII also contains a substrate-binding alpha+beta subdomain inserted in the core |
| Family b.85.7.1: Histone lysine methyltransferases [82200] (3 proteins) contains metal-binding preSET and postSET domains |
| Protein Histone H3 K4-specific methyltransferase SET7/9 catalytic domain [82205] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [82206] (7 PDB entries) |
| Domain d1xqha2: 1xqh A:193-366 [115847] Other proteins in same PDB: d1xqha1, d1xqhe1 |
PDB Entry: 1xqh (more details), 1.75 Å
SCOP Domain Sequences for d1xqha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xqha2 b.85.7.1 (A:193-366) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens)}
fdkstsscistnallpdpyeservyvaeslissageglfskvavgpntvmsfyngvrith
qevdsrdwalngntlsldeetvidvpepynhvskycaslghkanhsftpnciydmfvhpr
fgpikcirtlraveadeeltvaygydhsppgksgpeapewyqvelkafqatqqk
Timeline for d1xqha2: