SCOPe 2.08: Domain d1xqha2: 1xqh A:194-366

Lineage for d1xqha2 (1xqh A:194-366)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.7: SET domain [82199] (4 families)
   duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
   also contains a substrate-binding alpha+beta subdomain inserted in the core
   Pfam PF00856

5. Family b.85.7.1: Histone lysine methyltransferases [82200] (3 proteins)
   contains metal-binding preSET (Pfam PF05033) or AWS (Associated With SET, Pfam PF17907), and postSET domains

6. Protein Histone H3 K4-specific methyltransferase SET7/9 catalytic domain [82205] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82206] (19 PDB entries)
   Uniprot Q8WTS6 52-336

8. Domain d1xqha2: 1xqh A:194-366 [115847]
   Other proteins in same PDB: d1xqha1, d1xqhe1
   complexed with sah

Details for d1xqha2

PDB Entry: 1xqh, 1.75 Å

PDB Description: Crystal structure of a ternary complex of the methyltransferase SET9 (also known as SET7/9) with a P53 peptide and SAH

PDB Compounds: (A:) histone-lysine n-methyltransferase, h3 lysine-4 specific

SCOPe Domain Sequences for d1xqha2:

Sequence; same for both SEQRES and ATOM records:

>d1xqha2 b.85.7.1 (A:194-366) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
dkstsscistnallpdpyeservyvaeslissageglfskvavgpntvmsfyngvrithq
evdsrdwalngntlsldeetvidvpepynhvskycaslghkanhsftpnciydmfvhprf
gpikcirtlraveadeeltvaygydhsppgksgpeapewyqvelkafqatqqk

Timeline for d1xqha2:

• d1xqha2 first appeared in SCOP 1.71
  
• d1xqha2 appears in SCOPe 2.07