![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.76: open-sided beta-meander [51086] (2 superfamilies) single sheet formed by beta-hairpin repeats; exposed on both sides in the middle |
![]() | Superfamily b.76.2: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82185] (1 family) ![]() 11+ stranded sheet partly folded upon itself at the C-end |
![]() | Family b.76.2.1: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82186] (1 protein) |
![]() | Protein Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82187] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [82188] (19 PDB entries) Uniprot Q8WTS6 52-366 |
![]() | Domain d1xqha1: 1xqh A:117-193 [115846] Other proteins in same PDB: d1xqha2, d1xqhe2 N-terminally truncated complexed with sah |
PDB Entry: 1xqh (more details), 1.75 Å
SCOPe Domain Sequences for d1xqha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xqha1 b.76.2.1 (A:117-193) Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} gvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklatlmste egrphfelmpgnsvyhf
Timeline for d1xqha1: