SCOPe 2.02: Domain d1xqha1: 1xqh A:117-193

Lineage for d1xqha1 (1xqh A:117-193)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.76: open-sided beta-meander [51086] (2 superfamilies)
   single sheet formed by beta-hairpin repeats; exposed on both sides in the middle

4. Superfamily b.76.2: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82185] (1 family)
   11+ stranded sheet partly folded upon itself at the C-end

5. Family b.76.2.1: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82186] (1 protein)

6. Protein Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82187] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82188] (11 PDB entries)
   Uniprot Q8WTS6 52-366

8. Domain d1xqha1: 1xqh A:117-193 [115846]
   Other proteins in same PDB: d1xqha2, d1xqhe2
   N-terminally truncated
   complexed with sah

Details for d1xqha1

PDB Entry: 1xqh, 1.75 Å

PDB Description: Crystal structure of a ternary complex of the methyltransferase SET9 (also known as SET7/9) with a P53 peptide and SAH

PDB Compounds: (A:) histone-lysine n-methyltransferase, h3 lysine-4 specific

SCOPe Domain Sequences for d1xqha1:

Sequence; same for both SEQRES and ATOM records:

>d1xqha1 b.76.2.1 (A:117-193) Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
gvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklatlmste
egrphfelmpgnsvyhf

Timeline for d1xqha1:

• d1xqha1 first appeared in SCOP 1.71
  
• d1xqha1 appears in SCOPe 2.01
  
• d1xqha1 appears in SCOPe 2.03
  
• d1xqha1 appears in the current release, SCOPe 2.08