Lineage for d1xqha1 (1xqh A:117-193)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2402454Fold b.76: open-sided beta-meander [51086] (2 superfamilies)
    single sheet formed by beta-hairpin repeats; exposed on both sides in the middle
  4. 2402489Superfamily b.76.2: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82185] (1 family) (S)
    11+ stranded sheet partly folded upon itself at the C-end
  5. 2402490Family b.76.2.1: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82186] (1 protein)
  6. 2402491Protein Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82187] (1 species)
  7. 2402492Species Human (Homo sapiens) [TaxId:9606] [82188] (19 PDB entries)
    Uniprot Q8WTS6 52-366
  8. 2402515Domain d1xqha1: 1xqh A:117-193 [115846]
    Other proteins in same PDB: d1xqha2, d1xqhe2
    N-terminally truncated
    complexed with sah

Details for d1xqha1

PDB Entry: 1xqh (more details), 1.75 Å

PDB Description: Crystal structure of a ternary complex of the methyltransferase SET9 (also known as SET7/9) with a P53 peptide and SAH
PDB Compounds: (A:) histone-lysine n-methyltransferase, h3 lysine-4 specific

SCOPe Domain Sequences for d1xqha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xqha1 b.76.2.1 (A:117-193) Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
gvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklatlmste
egrphfelmpgnsvyhf

SCOPe Domain Coordinates for d1xqha1:

Click to download the PDB-style file with coordinates for d1xqha1.
(The format of our PDB-style files is described here.)

Timeline for d1xqha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xqha2