Lineage for d1xqea_ (1xqe A:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2256200Fold f.44: Ammonium transporter [111351] (1 superfamily)
    11 transmembrane helices; duplication: consist of 2 structural repeats of five helices each plus extra C-terminal helix
  4. 2256201Superfamily f.44.1: Ammonium transporter [111352] (2 families) (S)
    automatically mapped to Pfam PF00909
  5. 2256202Family f.44.1.1: Ammonium transporter [111353] (1 protein)
    Pfam PF00909
  6. 2256203Protein Ammonium transporter AmtB [111354] (1 species)
  7. 2256204Species Escherichia coli [TaxId:562] [111355] (5 PDB entries)
    Uniprot P37905 2-407
  8. 2256208Domain d1xqea_: 1xqe A: [115842]
    complexed with act, so4

Details for d1xqea_

PDB Entry: 1xqe (more details), 2.1 Å

PDB Description: the mechanism of ammonia transport based on the crystal structure of amtb of e. coli.
PDB Compounds: (A:) Probable ammonium transporter

SCOPe Domain Sequences for d1xqea_:

Sequence, based on SEQRES records: (download)

>d1xqea_ f.44.1.1 (A:) Ammonium transporter AmtB {Escherichia coli [TaxId: 562]}
avadkadnafmmictalvlfmtipgialfygglirgknvlsmltqvtvtfalvcilwvvy
gyslafgegnnffgninwlmlknieltavmgsiyqyihvafqgsfacitvglivgalaer
irfsavlifvvvwltlsyipiahmvwgggllashgaldfaggtvvhinaaiaglvgayli
gkrvgfgkeafkphnlpmvftgtailyigwfgfnagsagtaneiaalafvntvvataaai
lgwifgewalrgkpsllgacsgaiaglvgvtpacgyigvggaliigvvaglaglwgvtml
krllrvddpcdvfgvhgvcgivgcimtgifaasslggvgfaegvtmghqllvqlesiait
ivwsgvvafigykladltvglrvp

Sequence, based on observed residues (ATOM records): (download)

>d1xqea_ f.44.1.1 (A:) Ammonium transporter AmtB {Escherichia coli [TaxId: 562]}
avadkadnafmmictalvlfmtipgialfygglirgknvlsmltqvtvtfalvcilwvvy
gyslafgegnnffgninwlmlknieltavmgsiyqyihvafqgsfacitvglivgalaer
irfsavlifvvvwltlsyipiahmvwgggllashgaldfaggtvvhinaaiaglvgayli
gphnlpmvftgtailyigwfgfnagsagtaneiaalafvntvvataaailgwifgewalr
gkpsllgacsgaiaglvgvtpacgyigvggaliigvvaglaglwgvtmddpcdvfgvhgv
cgivgcimtgifaasslggvgfaegvtmghqllvqlesiaitivwsgvvafigykladlt
vglrvp

SCOPe Domain Coordinates for d1xqea_:

Click to download the PDB-style file with coordinates for d1xqea_.
(The format of our PDB-style files is described here.)

Timeline for d1xqea_: