Lineage for d1xqda_ (1xqd A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 542252Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 542253Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 542254Family a.104.1.1: Cytochrome P450 [48265] (21 proteins)
  6. 542405Protein Cytochrome P450-NOR, nitric reductase [48270] (1 species)
  7. 542406Species Fungus (Fusarium oxysporum) [TaxId:5507] [48271] (18 PDB entries)
  8. 542420Domain d1xqda_: 1xqd A: [115841]
    complexed with dnd, hem; mutant

Details for d1xqda_

PDB Entry: 1xqd (more details), 1.8 Å

PDB Description: Crystal structure of P450NOR complexed with 3-pyridinealdehyde adenine dinucleotide

SCOP Domain Sequences for d1xqda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xqda_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum)}
apsfpfsrasgpeppaefaklratnpvsqvklfdgslawlvtkhkdvcfvatseklskvr
trqgfpelgaggkqaakakptfvdmdppehmhqrsmveptftpeavknlqpyiqrtvddl
leqmkqkgcangpvdlvkefalpvpsyiiytllgvpfndleyltqqnairtngsstarqa
saanqelldylailveqrlvepkddiisklcteqvkpgnidksdavqiaflllvagnatm
vnmialgvatlaqhpdqlaqlkanpslapqfveelcryhtasalaikrtakedvmigdkl
vranegiiasnqsanrdeevfenpdefnmnrkwppqdplgfgfgdhrciaehlakaeltt
vfstlyqkfpdlkvavplgkinytplnrdvgivdlpvif

SCOP Domain Coordinates for d1xqda_:

Click to download the PDB-style file with coordinates for d1xqda_.
(The format of our PDB-style files is described here.)

Timeline for d1xqda_: