Lineage for d1xqda_ (1xqd A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005324Protein Cytochrome P450-NOR, nitric reductase [48270] (1 species)
  7. 2005325Species Fungus (Fusarium oxysporum) [TaxId:5507] [48271] (18 PDB entries)
    Uniprot P23295
  8. 2005339Domain d1xqda_: 1xqd A: [115841]
    complexed with dnd, hem

Details for d1xqda_

PDB Entry: 1xqd (more details), 1.8 Å

PDB Description: Crystal structure of P450NOR complexed with 3-pyridinealdehyde adenine dinucleotide
PDB Compounds: (A:) cytochrome p450 55a1

SCOPe Domain Sequences for d1xqda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xqda_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]}
apsfpfsrasgpeppaefaklratnpvsqvklfdgslawlvtkhkdvcfvatseklskvr
trqgfpelgaggkqaakakptfvdmdppehmhqrsmveptftpeavknlqpyiqrtvddl
leqmkqkgcangpvdlvkefalpvpsyiiytllgvpfndleyltqqnairtngsstarqa
saanqelldylailveqrlvepkddiisklcteqvkpgnidksdavqiaflllvagnatm
vnmialgvatlaqhpdqlaqlkanpslapqfveelcryhtasalaikrtakedvmigdkl
vranegiiasnqsanrdeevfenpdefnmnrkwppqdplgfgfgdhrciaehlakaeltt
vfstlyqkfpdlkvavplgkinytplnrdvgivdlpvif

SCOPe Domain Coordinates for d1xqda_:

Click to download the PDB-style file with coordinates for d1xqda_.
(The format of our PDB-style files is described here.)

Timeline for d1xqda_: