Lineage for d1xqbb_ (1xqb B:)

  1. Root: SCOP 1.71
  2. 617324Class e: Multi-domain proteins (alpha and beta) [56572] (48 folds)
  3. 619366Fold e.56: YaeB-like [118195] (1 superfamily)
    2 domains; d1: [beta-barrel (n=6, S=10), similar to the Reductase/isomerase/elongation factor common domain fold (scop_cf 50412), provides homodimerisation interface]; d2: [alpha+beta (disordered)]
  4. 619367Superfamily e.56.1: YaeB-like [118196] (1 family) (S)
  5. 619368Family e.56.1.1: YaeB-like [118197] (1 protein)
    Pfam 01980
  6. 619369Protein Hypothetical protein HI0510 [118198] (1 species)
  7. 619370Species Haemophilus influenzae [TaxId:727] [118199] (1 PDB entry)
  8. 619372Domain d1xqbb_: 1xqb B: [115840]
    Structural genomics target
    mutant

Details for d1xqbb_

PDB Entry: 1xqb (more details), 2.85 Å

PDB Description: x-ray structure of yaeb from haemophilus influenzae. northeast structural genomics research consortium (nesgc)target ir47.

SCOP Domain Sequences for d1xqbb_:

Sequence, based on SEQRES records: (download)

>d1xqbb_ e.56.1.1 (B:) Hypothetical protein HI0510 {Haemophilus influenzae}
mndltlspiaiihtpykekfsvprqpnlvedgvgivellppynspeavrgleqfshlwli
fqmdqiqqgkwqptvrpprlggnqrvgvfasrathrpnplgmskvelrqvecingniflh
lgavdlvdgtpifdikpyiayadsepnaqssfaqeklpvkmtvefteqaksavkkreekr
phlsrfirqvleqdprpayqqgkpsdriygmslyefnvkwrikagtvncve

Sequence, based on observed residues (ATOM records): (download)

>d1xqbb_ e.56.1.1 (B:) Hypothetical protein HI0510 {Haemophilus influenzae}
mndltlspiaiihtpykekfsvprqpnlvedgvgivellppynspeavrgleqfshlwli
fqmvgvfasrathrpnplgmskvelrqvecingniflhlgavdlvdgtpifdikpyiaya
dsepnaqssvkmtvefteqaksavkkreekrphlsrfirqvledriygmslyefnvkwag
tvncve

SCOP Domain Coordinates for d1xqbb_:

Click to download the PDB-style file with coordinates for d1xqbb_.
(The format of our PDB-style files is described here.)

Timeline for d1xqbb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xqba_