Lineage for d1xqba_ (1xqb A:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2626163Fold e.56: YaeB-like [118195] (1 superfamily)
    2 domains; d1: [beta-barrel (n=6, S=10), similar to the Reductase/isomerase/elongation factor common domain fold (50412), provides homodimerisation interface]; d2: [alpha+beta (disordered)]
  4. 2626164Superfamily e.56.1: YaeB-like [118196] (1 family) (S)
  5. 2626165Family e.56.1.1: YaeB-like [118197] (1 protein)
    Pfam PF01980
  6. 2626166Protein Hypothetical protein HI0510 [118198] (1 species)
  7. 2626167Species Haemophilus influenzae [TaxId:727] [118199] (1 PDB entry)
    Uniprot P44740
  8. 2626168Domain d1xqba_: 1xqb A: [115839]
    Structural genomics target

Details for d1xqba_

PDB Entry: 1xqb (more details), 2.85 Å

PDB Description: x-ray structure of yaeb from haemophilus influenzae. northeast structural genomics research consortium (nesgc)target ir47.
PDB Compounds: (A:) Hypothetical UPF0066 protein HI0510

SCOPe Domain Sequences for d1xqba_:

Sequence, based on SEQRES records: (download)

>d1xqba_ e.56.1.1 (A:) Hypothetical protein HI0510 {Haemophilus influenzae [TaxId: 727]}
mndltlspiaiihtpykekfsvprqpnlvedgvgivellppynspeavrgleqfshlwli
fqmdqiqqgkwqptvrpprlggnqrvgvfasrathrpnplgmskvelrqvecingniflh
lgavdlvdgtpifdikpyiayadsepnaqssfaqeklpvkmtvefteqaksavkkreekr
phlsrfirqvleqdprpayqqgkpsdriygmslyefnvkwrikagtvncve

Sequence, based on observed residues (ATOM records): (download)

>d1xqba_ e.56.1.1 (A:) Hypothetical protein HI0510 {Haemophilus influenzae [TaxId: 727]}
mndltlspiaiihtpykekfsvprqpnlvedgvgivellppynspeavrgleqfshlwli
fqmvgvfasrathrpnplgmskvelrqvecingniflhlgavdlvdgtpifdikpyiaya
dsepnaqssvkmtvefteqaksavkkreekrphlsrfirqvledriygmslyefnvkwag
tvncve

SCOPe Domain Coordinates for d1xqba_:

Click to download the PDB-style file with coordinates for d1xqba_.
(The format of our PDB-style files is described here.)

Timeline for d1xqba_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xqbb_