SCOP 1.73: Domain d1xqaa_: 1xqa A:

Lineage for d1xqaa_ (1xqa A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (10 families)

5. Family d.32.1.2: Antibiotic resistance proteins [54598] (6 proteins)
   duplication: consists of two clear structural repeats each having this fold
   subunit fold and dimeric assembly are similar to those of glyoxalase

6. Protein Hypothetical protein BC3580 [117870] (1 species)

7. Species Bacillus cereus [TaxId:1396] [117871] (1 PDB entry)

8. Domain d1xqaa_: 1xqa A: [115837]

Details for d1xqaa_

PDB Entry: 1xqa, 1.8 Å

PDB Description: Structure of a possible Glyoxalase from Bacillus cereus

PDB Compounds: (A:) Glyoxalase/Bleomycin resistance protein

SCOP Domain Sequences for d1xqaa_:

Sequence, based on SEQRES records:

>d1xqaa_ d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillus cereus [TaxId: 1396]}
amgikhlnltvadvvaareflekyfgltcsgtrgnafavmrdndgfiltlmkgkevqypk
tfhvgfpqeseeqvdkinqrlkedgflveppkhahaytfyveapggftievmc

Sequence, based on observed residues (ATOM records):

>d1xqaa_ d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillus cereus [TaxId: 1396]}
amgikhlnltvadvvaareflekyfgltcsgtrgnafavmrdndgfiltlmkgkevqypk
tfhvgfpqeseeqvdkinqrlkedgflveppkhaaytfyveapggftievmc

Timeline for d1xqaa_:

• d1xqaa_ first appeared in SCOP 1.71
  
• d1xqaa_ appears in SCOP 1.75
  
• d1xqaa_ appears in the current release, SCOPe 2.08, called d1xqaa1