SCOPe 2.06: Domain d1xq9b_: 1xq9 B:

Lineage for d1xq9b_ (1xq9 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest

4. Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families)

5. Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins)

6. Protein Phosphoglycerate mutase [53256] (6 species)

7. Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [117668] (1 PDB entry)
   Uniprot Q8IIG6

8. Domain d1xq9b_: 1xq9 B: [115836]
   Other proteins in same PDB: d1xq9a2
   Structural genomics target
   complexed with scn

Details for d1xq9b_

PDB Entry: 1xq9, 2.58 Å

PDB Description: structure of phosphoglycerate mutase from plasmodium falciparum at 2.6 resolution

PDB Compounds: (B:) phosphoglycerate mutase

SCOPe Domain Sequences for d1xq9b_:

Sequence; same for both SEQRES and ATOM records:

>d1xq9b_ c.60.1.1 (B:) Phosphoglycerate mutase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
ttytlvllrhgestwnkenkftgwtdvplsekgeeeaiaagkylkeknfkfdvvytsvlk
raictawnvlktadllhvpvvktwrlnerhygslqglnksetakkygeeqvkiwrrsydi
pppkldkednrwpghnvvyknvpkdalpfteclkdtvervlpfwfdhiapdilankkvmv
aahgnslrglvkhldnlseadvlelniptgvplvyeldenlkpikhyylldseelkkkmd

Timeline for d1xq9b_:

• d1xq9b_ first appeared in SCOP 1.71
  
• d1xq9b_ appears in SCOPe 2.05
  
• d1xq9b_ appears in SCOPe 2.07
  
• d1xq9b_ appears in the current release, SCOPe 2.08