Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest |
Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) |
Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins) |
Protein Phosphoglycerate mutase [53256] (6 species) |
Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [117668] (1 PDB entry) Uniprot Q8IIG6 |
Domain d1xq9a_: 1xq9 A: [115835] Structural genomics target complexed with scn |
PDB Entry: 1xq9 (more details), 2.58 Å
SCOPe Domain Sequences for d1xq9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xq9a_ c.60.1.1 (A:) Phosphoglycerate mutase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} mttytlvllrhgestwnkenkftgwtdvplsekgeeeaiaagkylkeknfkfdvvytsvl kraictawnvlktadllhvpvvktwrlnerhygslqglnksetakkygeeqvkiwrrsyd ipppkldkednrwpghnvvyknvpkdalpfteclkdtvervlpfwfdhiapdilankkvm vaahgnslrglvkhldnlseadvlelniptgvplvyeldenlkpikhyylldseelkkkm d
Timeline for d1xq9a_: