Lineage for d1xq8a_ (1xq8 A:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2647123Fold h.7: Synuclein [118374] (1 superfamily)
  4. 2647124Superfamily h.7.1: Synuclein [118375] (1 family) (S)
  5. 2647125Family h.7.1.1: Synuclein [118376] (2 proteins)
    Pfam PF01387
  6. 2647126Protein Alpha-synuclein [118377] (1 species)
  7. 2647127Species Human (Homo sapiens) [TaxId:9606] [118378] (1 PDB entry)
    Uniprot P37840 1-140
  8. 2647128Domain d1xq8a_: 1xq8 A: [115834]
    micelle-bound NMR structure

Details for d1xq8a_

PDB Entry: 1xq8 (more details)

PDB Description: human micelle-bound alpha-synuclein
PDB Compounds: (A:) Alpha-synuclein

SCOPe Domain Sequences for d1xq8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xq8a_ h.7.1.1 (A:) Alpha-synuclein {Human (Homo sapiens) [TaxId: 9606]}
mdvfmkglskakegvvaaaektkqgvaeaagktkegvlyvgsktkegvvhgvatvaektk
eqvtnvggavvtgvtavaqktvegagsiaaatgfvkkdqlgkneegapqegiledmpvdp
dneayempseegyqdyepea

SCOPe Domain Coordinates for d1xq8a_:

Click to download the PDB-style file with coordinates for d1xq8a_.
(The format of our PDB-style files is described here.)

Timeline for d1xq8a_: