Lineage for d1xq7c_ (1xq7 C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2806645Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2806646Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2806647Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 2806648Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 2806886Species Trypanosoma cruzi [TaxId:5693] [117269] (2 PDB entries)
    Uniprot Q4DPB9 30-194
  8. 2806893Domain d1xq7c_: 1xq7 C: [115833]
    Structural genomics target

Details for d1xq7c_

PDB Entry: 1xq7 (more details), 2.07 Å

PDB Description: cyclophilin from trypanosoma cruzi bound to cyclosporin a
PDB Compounds: (C:) peptidyl-prolyl cis-trans isomerase

SCOPe Domain Sequences for d1xq7c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xq7c_ b.62.1.1 (C:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]}
mpvvtdkvyfditigdepvgrvviglfgndvpktvenfkqlasgengfgykgsifhrvir
nfmiqggdftnfdgtggksiygtrfddenlkikhfvgavsmanagpnsngsqffvttapt
pwldgrhvvfgkvvegmdvvkkventktglndkpkkavkindcgvl

SCOPe Domain Coordinates for d1xq7c_:

Click to download the PDB-style file with coordinates for d1xq7c_.
(The format of our PDB-style files is described here.)

Timeline for d1xq7c_: