| Class b: All beta proteins [48724] (180 folds) |
| Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
Superfamily b.62.1: Cyclophilin-like [50891] (5 families) ![]() |
| Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins) automatically mapped to Pfam PF00160 |
| Protein Cyclophilin (eukaryotic) [50893] (13 species) |
| Species Trypanosoma cruzi [TaxId:5693] [117269] (2 PDB entries) Uniprot Q4DPB9 30-194 |
| Domain d1xq7c_: 1xq7 C: [115833] Structural genomics target |
PDB Entry: 1xq7 (more details), 2.07 Å
SCOPe Domain Sequences for d1xq7c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xq7c_ b.62.1.1 (C:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]}
mpvvtdkvyfditigdepvgrvviglfgndvpktvenfkqlasgengfgykgsifhrvir
nfmiqggdftnfdgtggksiygtrfddenlkikhfvgavsmanagpnsngsqffvttapt
pwldgrhvvfgkvvegmdvvkkventktglndkpkkavkindcgvl
Timeline for d1xq7c_: