Lineage for d1xq7b_ (1xq7 B:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 565060Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 565061Superfamily b.62.1: Cyclophilin-like [50891] (2 families) (S)
  5. 565062Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins)
  6. 565063Protein Cyclophilin (eukaryotic) [50893] (10 species)
  7. 565192Species Trypanosoma cruzi [TaxId:5693] [117269] (2 PDB entries)
  8. 565198Domain d1xq7b_: 1xq7 B: [115832]

Details for d1xq7b_

PDB Entry: 1xq7 (more details), 2.07 Å

PDB Description: cyclophilin from trypanosoma cruzi bound to cyclosporin a

SCOP Domain Sequences for d1xq7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xq7b_ b.62.1.1 (B:) Cyclophilin (eukaryotic) {Trypanosoma cruzi}
mpvvtdkvyfditigdepvgrvviglfgndvpktvenfkqlasgengfgykgsifhrvir
nfmiqggdftnfdgtggksiygtrfddenlkikhfvgavsmanagpnsngsqffvttapt
pwldgrhvvfgkvvegmdvvkkventktglndkpkkavkindcgvl

SCOP Domain Coordinates for d1xq7b_:

Click to download the PDB-style file with coordinates for d1xq7b_.
(The format of our PDB-style files is described here.)

Timeline for d1xq7b_: