Lineage for d1xq5d_ (1xq5 D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2300465Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2301227Species Yellow perch (Perca flavescens) [TaxId:8167] [116751] (4 PDB entries)
    Uniprot P83273; 86% sequence identity
  8. 2301235Domain d1xq5d_: 1xq5 D: [115828]
    Other proteins in same PDB: d1xq5a_, d1xq5c_
    Structural genomics target
    complexed with hem

Details for d1xq5d_

PDB Entry: 1xq5 (more details), 1.9 Å

PDB Description: Met-Perch Hemoglobin at 1.9A
PDB Compounds: (D:) Hemoglobin beta-2 chain

SCOPe Domain Sequences for d1xq5d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xq5d_ a.1.1.2 (D:) Hemoglobin, beta-chain {Yellow perch (Perca flavescens) [TaxId: 8167]}
vvwtdferatiadifskldyeavggatlarclivypwtqryfgnfgnlynaaaimgnpmi
akhgttilhgldravknmdnikatyaelsvlhseklhvdpdnfkllsdcltivvaaqlgk
afsgevqaafqkflsvvvsalgkqyh

SCOPe Domain Coordinates for d1xq5d_:

Click to download the PDB-style file with coordinates for d1xq5d_.
(The format of our PDB-style files is described here.)

Timeline for d1xq5d_: