Class a: All alpha proteins [46456] (226 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.2: Globins [46463] (26 proteins) Heme-binding protein |
Protein Hemoglobin, beta-chain [46500] (22 species) |
Species Yellow perch (Perca flavescens) [TaxId:8167] [116751] (1 PDB entry) |
Domain d1xq5d_: 1xq5 D: [115828] Other proteins in same PDB: d1xq5a_, d1xq5c_ Structural genomics target complexed with ace, hem |
PDB Entry: 1xq5 (more details), 1.9 Å
SCOP Domain Sequences for d1xq5d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xq5d_ a.1.1.2 (D:) Hemoglobin, beta-chain {Yellow perch (Perca flavescens)} vvwtdferatiadifskldyeavggatlarclivypwtqryfgnfgnlynaaaimgnpmi akhgttilhgldravknmdnikatyaelsvlhseklhvdpdnfkllsdcltivvaaqlgk afsgevqaafqkflsvvvsalgkqyh
Timeline for d1xq5d_: