Lineage for d1xq5c_ (1xq5 C:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 631651Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 631652Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 631691Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 631855Protein Hemoglobin, alpha-chain [46486] (19 species)
  7. 632302Species Yellow perch (Perca flavescens) [TaxId:8167] [116749] (1 PDB entry)
  8. 632304Domain d1xq5c_: 1xq5 C: [115827]
    Other proteins in same PDB: d1xq5b_, d1xq5d_
    Structural genomics target
    complexed with ace, hem

Details for d1xq5c_

PDB Entry: 1xq5 (more details), 1.9 Å

PDB Description: Met-Perch Hemoglobin at 1.9A
PDB Compounds: (C:) Hemoglobin alpha-1 chain

SCOP Domain Sequences for d1xq5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xq5c_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Yellow perch (Perca flavescens) [TaxId: 8167]}
slsskdkdtvkalwgkiadkaeeigsdalsrmlavypqtktyfshwkdlspgsapvnkhg
ktimggivdavasiddlnagllalselhaftlrvdpanfkilshcilvllavkfpkdftp
evhisydkffsalaralaekyr

SCOP Domain Coordinates for d1xq5c_:

Click to download the PDB-style file with coordinates for d1xq5c_.
(The format of our PDB-style files is described here.)

Timeline for d1xq5c_: