Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, alpha-chain [46486] (24 species) |
Species Yellow perch (Perca flavescens) [TaxId:8167] [116749] (1 PDB entry) Uniprot P83270; 78% sequence identity |
Domain d1xq5c_: 1xq5 C: [115827] Other proteins in same PDB: d1xq5b_, d1xq5d_ Structural genomics target complexed with hem |
PDB Entry: 1xq5 (more details), 1.9 Å
SCOPe Domain Sequences for d1xq5c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xq5c_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Yellow perch (Perca flavescens) [TaxId: 8167]} slsskdkdtvkalwgkiadkaeeigsdalsrmlavypqtktyfshwkdlspgsapvnkhg ktimggivdavasiddlnagllalselhaftlrvdpanfkilshcilvllavkfpkdftp evhisydkffsalaralaekyr
Timeline for d1xq5c_: