Lineage for d1xq4d_ (1xq4 D:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1771376Superfamily b.1.23: ApaG-like [110069] (1 family) (S)
  5. 1771377Family b.1.23.1: ApaG-like [110070] (1 protein)
    Pfam PF04379; dimeric in crystals; this dimer is a probable biological unit
  6. 1771378Protein ApaG [110071] (4 species)
  7. 1771379Species Bordetella pertussis [TaxId:520] [117064] (1 PDB entry)
    Uniprot Q7VU61
  8. 1771383Domain d1xq4d_: 1xq4 D: [115824]
    Structural genomics target
    complexed with po4

Details for d1xq4d_

PDB Entry: 1xq4 (more details), 2.7 Å

PDB Description: crystal structure of the putative apaa protein from bordetella pertussis, northeast structural genomics target ber40
PDB Compounds: (D:) Protein apaG

SCOPe Domain Sequences for d1xq4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xq4d_ b.1.23.1 (D:) ApaG {Bordetella pertussis [TaxId: 520]}
pvkpydltvsvtpryvpeqsdpsqqqyvfaytvritntgshpaqvisrhwiitdgeervq
evrglgvvgqqpllapgetfeytsgcplptpigtmrgtyhcvgengipfevpiaefllam
pr

SCOPe Domain Coordinates for d1xq4d_:

Click to download the PDB-style file with coordinates for d1xq4d_.
(The format of our PDB-style files is described here.)

Timeline for d1xq4d_: