Lineage for d1xq4c_ (1xq4 C:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 552548Superfamily b.1.23: ApaG-like [110069] (1 family) (S)
  5. 552549Family b.1.23.1: ApaG-like [110070] (1 protein)
    Pfam 04379; dimeric in crystals; this dimer is a probable biological unit
  6. 552550Protein ApaG [110071] (3 species)
  7. 552551Species Bordetella pertussis [TaxId:520] [117064] (1 PDB entry)
  8. 552554Domain d1xq4c_: 1xq4 C: [115823]

Details for d1xq4c_

PDB Entry: 1xq4 (more details), 2.7 Å

PDB Description: crystal structure of the putative apaa protein from bordetella pertussis, northeast structural genomics target ber40

SCOP Domain Sequences for d1xq4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xq4c_ b.1.23.1 (C:) ApaG {Bordetella pertussis}
pvkpydltvsvtpryvpeqsdpsqqqyvfaytvritntgshpaqvisrhwiitdgeervq
evrglgvvgqqpllapgetfeytsgcplptpigtmrgtyhcvgengipfevpiaefllam
pr

SCOP Domain Coordinates for d1xq4c_:

Click to download the PDB-style file with coordinates for d1xq4c_.
(The format of our PDB-style files is described here.)

Timeline for d1xq4c_: