![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.23: ApaG-like [110069] (2 families) ![]() |
![]() | Family b.1.23.1: ApaG-like [110070] (1 protein) Pfam PF04379; dimeric in crystals; this dimer is a probable biological unit |
![]() | Protein ApaG [110071] (4 species) |
![]() | Species Bordetella pertussis [TaxId:520] [117064] (1 PDB entry) Uniprot Q7VU61 |
![]() | Domain d1xq4b_: 1xq4 B: [115822] Structural genomics target complexed with po4 |
PDB Entry: 1xq4 (more details), 2.7 Å
SCOPe Domain Sequences for d1xq4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xq4b_ b.1.23.1 (B:) ApaG {Bordetella pertussis [TaxId: 520]} pvkpydltvsvtpryvpeqsdpsqqqyvfaytvritntgshpaqvisrhwiitdgeervq evrglgvvgqqpllapgetfeytsgcplptpigtmrgtyhcvgengipfevpiaefllam p
Timeline for d1xq4b_: