Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.23: ApaG-like [110069] (1 family) |
Family b.1.23.1: ApaG-like [110070] (1 protein) Pfam PF04379; dimeric in crystals; this dimer is a probable biological unit |
Protein ApaG [110071] (3 species) |
Species Bordetella pertussis [TaxId:520] [117064] (1 PDB entry) Uniprot Q7VU61 |
Domain d1xq4a_: 1xq4 A: [115821] Structural genomics target |
PDB Entry: 1xq4 (more details), 2.7 Å
SCOP Domain Sequences for d1xq4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xq4a_ b.1.23.1 (A:) ApaG {Bordetella pertussis [TaxId: 520]} pvkpydltvsvtpryvpeqsdpsqqqyvfaytvritntgshpaqvisrhwiitdgeervq evrglgvvgqqpllapgetfeytsgcplptpigtmrgtyhcvgengipfevpiaefllam prt
Timeline for d1xq4a_: