SCOP 1.73: Domain d1xq4a_: 1xq4 A:

Lineage for d1xq4a_ (1xq4 A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.23: ApaG-like [110069] (1 family)

5. Family b.1.23.1: ApaG-like [110070] (1 protein)
   Pfam PF04379; dimeric in crystals; this dimer is a probable biological unit

6. Protein ApaG [110071] (3 species)

7. Species Bordetella pertussis [TaxId:520] [117064] (1 PDB entry)

8. Domain d1xq4a_: 1xq4 A: [115821]

Details for d1xq4a_

PDB Entry: 1xq4, 2.7 Å

PDB Description: crystal structure of the putative apaa protein from bordetella pertussis, northeast structural genomics target ber40

PDB Compounds: (A:) Protein apaG

SCOP Domain Sequences for d1xq4a_:

Sequence; same for both SEQRES and ATOM records:

>d1xq4a_ b.1.23.1 (A:) ApaG {Bordetella pertussis [TaxId: 520]}
pvkpydltvsvtpryvpeqsdpsqqqyvfaytvritntgshpaqvisrhwiitdgeervq
evrglgvvgqqpllapgetfeytsgcplptpigtmrgtyhcvgengipfevpiaefllam
prt

Timeline for d1xq4a_:

• d1xq4a_ first appeared in SCOP 1.71
  
• d1xq4a_ appears in SCOP 1.75
  
• d1xq4a_ appears in the current release, SCOPe 2.08