Lineage for d1xq3a_ (1xq3 A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 543419Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 543420Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 543421Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (32 proteins)
  6. 543422Protein Androgen receptor [63621] (3 species)
  7. 543432Species Human (Homo sapiens) [TaxId:9606] [63623] (4 PDB entries)
  8. 543435Domain d1xq3a_: 1xq3 A: [115820]
    complexed with r18

Details for d1xq3a_

PDB Entry: 1xq3 (more details), 2.25 Å

PDB Description: Crystal structure of the human androgen receptor ligand binding domain bound with R1881

SCOP Domain Sequences for d1xq3a_:

Sequence, based on SEQRES records: (download)

>d1xq3a_ a.123.1.1 (A:) Androgen receptor {Human (Homo sapiens)}
piflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlhv
ddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrhl
sqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrknpt
scsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsgk
vkpiyfhtq

Sequence, based on observed residues (ATOM records): (download)

>d1xq3a_ a.123.1.1 (A:) Androgen receptor {Human (Homo sapiens)}
piflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlhv
ddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrhl
sqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiatscsrrf
yqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsgkvkpiyf
htq

SCOP Domain Coordinates for d1xq3a_:

Click to download the PDB-style file with coordinates for d1xq3a_.
(The format of our PDB-style files is described here.)

Timeline for d1xq3a_: