SCOP 1.73: Domain d1xpyc1: 1xpy C:133-375

Lineage for d1xpyc1 (1xpy C:133-375)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.2: D-glucarate dehydratase-like [51609] (13 proteins)

6. Protein N-acylamino acid racemase [110372] (4 species)

7. Species Deinococcus radiodurans [TaxId:1299] [110374] (4 PDB entries)

8. Domain d1xpyc1: 1xpy C:133-375 [115814]
   Other proteins in same PDB: d1xpya2, d1xpyb2, d1xpyc2, d1xpyd2

Details for d1xpyc1

PDB Entry: 1xpy, 2.3 Å

PDB Description: Structural Basis for Catalytic Racemization and Substrate Specificity of an N-Acylamino Acid Racemase Homologue from Deinococcus radiodurans

PDB Compounds: (C:) N-acylamino acid racemase

SCOP Domain Sequences for d1xpyc1:

Sequence; same for both SEQRES and ATOM records:

>d1xpyc1 c.1.11.2 (C:133-375) N-acylamino acid racemase {Deinococcus radiodurans [TaxId: 1299]}
hkeqvevgvslgiqadeqatvdlvrrhveqgyrriklkikpgwdvqpvratreafpdirl
tvdansaytladagrlrqldeydltyieqplawddlvdhaelarrirtplcldesvasas
darkalalgaggvinlkvarvgghaesrrvhdvaqsfgapvwcggmlesgigrahnihls
tlsnfrlpgdtssasrywerdliqepleavdglmpvpqgpgtgvtldreflatvteaqee
hra

Timeline for d1xpyc1:

• d1xpyc1 first appeared in SCOP 1.71
  
• d1xpyc1 appears in SCOP 1.75
  
• d1xpyc1 appears in the current release, SCOPe 2.08