Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.2: D-glucarate dehydratase-like [51609] (13 proteins) |
Protein N-acylamino acid racemase [110372] (4 species) |
Species Deinococcus radiodurans [TaxId:1299] [110374] (4 PDB entries) |
Domain d1xpyc1: 1xpy C:133-375 [115814] Other proteins in same PDB: d1xpya2, d1xpyb2, d1xpyc2, d1xpyd2 |
PDB Entry: 1xpy (more details), 2.3 Å
SCOP Domain Sequences for d1xpyc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xpyc1 c.1.11.2 (C:133-375) N-acylamino acid racemase {Deinococcus radiodurans [TaxId: 1299]} hkeqvevgvslgiqadeqatvdlvrrhveqgyrriklkikpgwdvqpvratreafpdirl tvdansaytladagrlrqldeydltyieqplawddlvdhaelarrirtplcldesvasas darkalalgaggvinlkvarvgghaesrrvhdvaqsfgapvwcggmlesgigrahnihls tlsnfrlpgdtssasrywerdliqepleavdglmpvpqgpgtgvtldreflatvteaqee hra
Timeline for d1xpyc1: