Lineage for d1xpwa_ (1xpw A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774509Family b.18.1.9: APC10-like [69210] (2 proteins)
    Pfam PF03256
  6. 2774516Protein Placental protein 25, pp25 [117104] (1 species)
  7. 2774517Species Human (Homo sapiens) [TaxId:9606] [117105] (2 PDB entries)
    Uniprot Q9Y547
  8. 2774519Domain d1xpwa_: 1xpw A: [115809]
    Structural genomics target

Details for d1xpwa_

PDB Entry: 1xpw (more details)

PDB Description: solution nmr structure of human protein hspco34. northeast structural genomics target hr1958
PDB Compounds: (A:) LOC51668 protein

SCOPe Domain Sequences for d1xpwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xpwa_ b.18.1.9 (A:) Placental protein 25, pp25 {Human (Homo sapiens) [TaxId: 9606]}
mrkidlclssegsevilatssdekhppeniidgnpetfwtttgmfpqefiicfhkhvrie
rlviqsyfvqtlkiekstskepvdfeqwiekdlvhtegqlqneeivahgsatylrfiivs
afdhfasvhsvsaegtvvsnlss

SCOPe Domain Coordinates for d1xpwa_:

Click to download the PDB-style file with coordinates for d1xpwa_.
(The format of our PDB-style files is described here.)

Timeline for d1xpwa_: