Lineage for d1xpud3 (1xpu D:129-417)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2477556Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2478063Protein Transcription termination factor Rho, ATPase domain [89676] (1 species)
  7. 2478064Species Escherichia coli [TaxId:562] [89677] (5 PDB entries)
    Uniprot P03002
  8. 2478068Domain d1xpud3: 1xpu D:129-417 [115801]
    Other proteins in same PDB: d1xpua1, d1xpua2, d1xpub1, d1xpub2, d1xpuc1, d1xpuc2, d1xpud1, d1xpud2, d1xpue1, d1xpue2, d1xpuf1, d1xpuf2
    protein/RNA complex; complexed with ags, fpd, mg

Details for d1xpud3

PDB Entry: 1xpu (more details), 3.05 Å

PDB Description: Structural mechanism of inhibition of the Rho transcription termination factor by the antibiotic 5a-(3-formylphenylsulfanyl)-dihydrobicyclomycin (FPDB)
PDB Compounds: (D:) Rho transcription termination factor

SCOPe Domain Sequences for d1xpud3:

Sequence, based on SEQRES records: (download)

>d1xpud3 c.37.1.11 (D:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]}
nkilfenltplhansrlrmergngstedltarvldlaspigrgqrglivappkagktmll
qniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemvie
kakrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrpkrffgaarnve
eggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrke
ellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk

Sequence, based on observed residues (ATOM records): (download)

>d1xpud3 c.37.1.11 (D:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]}
nkilfenltplhansrlrmgstedltarvldlaspigrgqrglivappkagktmllqnia
qsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemviekakr
lvehkkdviilldsitrlarayntvvpavltggvdanalhrpkrffgaarnveeggslti
iatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrkeellttqe
elqkmwilrkiihpmgeidameflinklamtktnddffemmk

SCOPe Domain Coordinates for d1xpud3:

Click to download the PDB-style file with coordinates for d1xpud3.
(The format of our PDB-style files is described here.)

Timeline for d1xpud3: