Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
Protein Transcription termination factor Rho, ATPase domain [89676] (1 species) |
Species Escherichia coli [TaxId:562] [89677] (5 PDB entries) Uniprot P03002 |
Domain d1xpud3: 1xpu D:129-417 [115801] Other proteins in same PDB: d1xpua1, d1xpua2, d1xpub1, d1xpub2, d1xpuc1, d1xpuc2, d1xpud1, d1xpud2, d1xpue1, d1xpue2, d1xpuf1, d1xpuf2 protein/RNA complex; complexed with ags, fpd, mg |
PDB Entry: 1xpu (more details), 3.05 Å
SCOPe Domain Sequences for d1xpud3:
Sequence, based on SEQRES records: (download)
>d1xpud3 c.37.1.11 (D:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} nkilfenltplhansrlrmergngstedltarvldlaspigrgqrglivappkagktmll qniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemvie kakrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrpkrffgaarnve eggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrke ellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk
>d1xpud3 c.37.1.11 (D:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} nkilfenltplhansrlrmgstedltarvldlaspigrgqrglivappkagktmllqnia qsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemviekakr lvehkkdviilldsitrlarayntvvpavltggvdanalhrpkrffgaarnveeggslti iatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrkeellttqe elqkmwilrkiihpmgeidameflinklamtktnddffemmk
Timeline for d1xpud3: